PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G189500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 337aa    MW: 35787.3 Da    PI: 8.7016
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G189500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-1654101148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+W +eEd+llvd v+  G+g+W+  ++  g++R++k+c++rw +yl
  Sevir.7G189500.1.p  54 KGPWAPEEDKLLVDFVQANGPGNWRMLPKLAGLNRCGKSCRLRWTNYL 101
                         79********************************************97 PP

2Myb_DNA-binding53.36.4e-17107152148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+eE+  +v++++  G++ W+ Ia+ ++ gRt++++k++w+++l
  Sevir.7G189500.1.p 107 RGPFTPEEHNSIVQLHAVVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 152
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.25649101IPR017930Myb domain
SuperFamilySSF466891.39E-3051148IPR009057Homeodomain-like
SMARTSM007171.5E-1253103IPR001005SANT/Myb domain
PfamPF002492.7E-1454101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2255108IPR009057Homeodomain-like
CDDcd001673.22E-956101No hitNo description
PROSITE profilePS5129427.326102156IPR017930Myb domain
SMARTSM007178.5E-15106154IPR001005SANT/Myb domain
PfamPF002491.2E-14107152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-27109156IPR009057Homeodomain-like
CDDcd001671.10E-10109152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MATAPPPPPL TPRSRRRRCR RHRGRTESDR RRSAAAAAAS MGRTPCCDSK GIKKGPWAPE  60
EDKLLVDFVQ ANGPGNWRML PKLAGLNRCG KSCRLRWTNY LRPDIKRGPF TPEEHNSIVQ  120
LHAVVGNKWS MIAAQLPGRT DNEIKNYWNT HLKKQLRQEA LAGADAAAAQ QLALSAAAAS  180
PCPAARHMAQ WETARLEAEA RLSLLSSSAA TTLTSAAAAA AAAAASSSSS TAAEHAAPDI  240
FLRLWNSEVG ESFRGTAHGP AEAGAPALLP APRGGDDSSA ASTNGTEAAD DYHAFLELAV  300
EEFALLHGRL GGAFSEFTPV DVHVLAEASC LFTPFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27541567108B-MYB
1mse_C1e-27541564105C-Myb DNA-Binding Domain
1msf_C1e-27541564105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-118AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008661372.11e-140PREDICTED: putative homeodomain-like transcription factor superfamily protein isoform X2
RefseqXP_008669097.11e-140PREDICTED: anthocyanin regulatory C1 protein-like
TrEMBLA0A096S0H01e-141A0A096S0H0_MAIZE; Uncharacterized protein
STRINGGRMZM2G123202_P011e-141(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.14e-66myb domain protein 17